Selecting the Gene Sequences

There are enormous data bases for many genomes available free of charge on the web. One very popular Swiss one called UNIPROT specializes in the amino acid sequences of the proteins but has the disadvantage that it does not give the terminating sequence (the instruction to stop making the protein). So for the human genome, I mostly used ENSEMBL (very well known) and CCDS, which do. I looked at the way the genes were arranged in the chromosome, chose one and downloaded the translated amino acid sequence. This was then formatted and stored in a file for reading by a BASIC program, Aareader4.bas (Liberty Basic professional version, 2015), which translated the amino acids into Hebrew letter equivalents, and searched for various sequences, especially names of God.

In the end to save time when bulk searching was necessary, the first half dozen genes from each of the chromosomes were translated to Hebrew letters and combined. This gave 100,000 Amino acids, about 2% of all those specified by the genes, so it’s only a very small sample.

I now take a moderate length gene called TRNT1 and see what the transliteration is for Latin, English and Hebrew. It is 435 amino acids long, each letter representing an amino acid.

Latin

Latin words in red were found in the Perseus Latin web resource (some words are jammed together). Names of God are in blue and meaningless combinations in black.

YENXEFHYHNSREQNNYINEXESMLFEPOYMELISAPLiEPOATEMIEOAEPRMAQHAENDUTTURNCEEQTRMSLCDCPUOOUOSOLYMAYPLIUTDNYDQQNTAMHTODOUNEHAAQPADOOENDCROOCTNHUARAPOOCYLMCUANNCEODQIYPETPCTOEPCFPQTFACEMQMMRNPRTHUMLNDLACFENDENFPNPFTNDRCMSTCHCSAOEAUDUAQUMTEUTDITANDYRAEMMDERTQHRQHEDHEDFCECRUSFDTSUQUIEAAPCMRIMQRCTPISMSROEEUIEPMRLCCROMECENEMDUMAAMQETEPDRMQNMCEDMUOCIICSEMSFLCPDDCINASCUOONRXAEEMFLTAHXEEMAYLLYIDSSPSRITHCDNMRTDIITMADTUEELLENALYMMITFLYAMCAEEIFDMMO

Rapo is a robber, Face is a command to an individual to make or do, (perhaps it is a phrase, like “do it!”), and Fende means “fiend”! But many of the small words are such specialist vocabulary that you may not know them. There are two names of God (DI). 31% of the letters make words.

English for the same gene

With 26 letters in the alphabet English was a poor fit, but you can see how the process goes. In the sequence DOEMSROWGOEH there are 5 possible words: do, ems (a measure of size in typography), row, go and eh. But they make no sense run together.

PEHYEFGBGHNSEWHHBTHEYENRCFEMDPRECTNOMCTEMDOIERTEDOEMSROWGOEHUAIIASHLEEWISRNCLULMADDADNDCPROPMCTAIUHPUWWHIORGIDUDAHEGOOWMOUDDEHULSDDLIHGAOSOMDDLBCRLAOHHLEDUWTPMEIMLIDEMLFMWIFOLERWRRSHMSIGARCHUCOLFEHUEHFMHMFIHUSLRNILGLNODEOAUAOWARIEAIUTIOHUBSOERRUESIWGSWGEUGEUFLELSANFUIENAWATEOOMLRSTRWSLIMTNRNSDEEATEMRSCLLSDRELEHERUAROORWEIEMUSRWHRLEURADLTTLNERNFCLMUULTHONLADDHSYOEERFCIOGYEEROPCCBTUNNMNSTIGLUHRSIUTTIROUIAEECCEHOCBRRTIFCPORLOEETFURRD

There are visually more red letters. Three poor phrases from this sequence are “Ash is mad, Dad”, “On, Lad!” “Lo! Fur”. English has the advantage that “A”, “O” and “I” can be words. There are no names of God. 51% of the letters make words.

Hebrew for the same gene

GYBFYPQZQBLRYJBBZWBYFYLTKPYDSGTYKWLMDKWYDSMAYTWYSMYDRTMJQMYB^cHAAHRBNYYJARTLKN^cNDHSSHSLSKGTMGDKWHAcBG^cJJBAMTQAS^cSHBYQMMJDM^cSSYB^cNRSSNABQHMRMDSSNZKTNHMBBNYS^cJWGDYADNASYDNPDJAPMNYTJTTRBDRAQHTKB^cKMNPYBcYBPDBDPAB^cRNTLANQNLMSYMH^cHMJHTAYHA^cWAMB^cZRMYTT^cYRAJQRJQY^cQY^cPNYNRHLP^cAYLHJHWYMMDNTRWTJRNADWLTLRSYYHWYDTRKNNRSTYNYBYT^cHTMMTJYAYD^cRTJBTNY^cTHSNWWNLYTLPKND^ccNWBMLNHSSBRFMYYTPKAMQFYYTMGKKZW^cLLDLRWAQN^cBTRA^cWWATM^cAHYYKKYBMKZTTWAPKGMTNMYYWP^cTTSE

You can see many more red words than for the Latin and English. Most of the Hebrew is interpretable as words. There are 26 phrases and 9 names of God. See here for the reason YY is also a name of God. 82% of the letters make words.

No vowels? It seems the Hebrews had a tendency to write in shorthand! It means you can insert the vowels as you see fit, so that there are often multiple possibilities for words and, therefore, for meanings of a phrase. The Hebrew seems to communicate much more and fits more naturally, so I preferred it to Latin and English.